PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim09g066030.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 724aa    MW: 82706.9 Da    PI: 6.8181
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim09g066030.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox566.8e-182577456
                        -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                         ++++ eq+++Le++F+k+++p++++ ++LA++ gL+ +qVk+WFqN+R++ k
  Sopim09g066030.0.1 25 YHRHSMEQIQRLEAFFNKCPHPDEDQQKQLAREAGLDHKQVKFWFQNKRTQTK 77
                        567899********************************************988 PP

2START106.25.3e-342464635205
                         HHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEE CS
               START   5 eaaqelvkkalaeepgWvkss...esengdevlqkfeeskv.......dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                         + ++e v + + ++p+Wv  s   + ++  e++ +  +++v        ++e ++++g+v m++++l   +ld   +W + ++    ka t
  Sopim09g066030.0.1 246 ASMNEMVELWKTNDPFWVDPSsdeKFSIHRESYGRKYSNQVlpyetstTRIESSKDCGIVSMTAVELIHNFLDPV-KWMNLFPtivtKART 335
                         67999999999*******9887774444445555444555566667999*************************9.99999999999**** PP

                         EEEECTT...EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE CS
               START  82 levissg...galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwve 168
                         +ev++sg   g +qlm+ +l  lsplv  R+f f+R++rql a +w+ vdvS d  ++ ++ +++  + ++pSg++i++++ng skvtwve
  Sopim09g066030.0.1 336 IEVLDSGtwgGSIQLMYEKLHILSPLVEaREFFFIRCCRQLDATTWIMVDVSYDIFNEIQSGAPCY-SWKFPSGCVIQDMGNGQSKVTWVE 425
                         ***************************99*********************9999887776444443.579********************* PP

                         -EE-.-SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
               START 169 hvdl.kgrlphwllrslvksglaegaktwvatlqrqce 205
                         hv   +++++  ++r l+  + a gak+w  tlqr  e
  Sopim09g066030.0.1 426 HVQIfEKYQVNRIFRDLLCGREAYGAKRWIVTLQRMSE 463
                         ***7366788************************9877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-18677IPR009057Homeodomain-like
SuperFamilySSF466897.52E-171180IPR009057Homeodomain-like
SMARTSM003896.9E-141783IPR001356Homeobox domain
CDDcd000862.92E-141880No hitNo description
PROSITE profilePS5007115.8561979IPR001356Homeobox domain
PfamPF000462.0E-152577IPR001356Homeobox domain
PROSITE patternPS0002705477IPR017970Homeobox, conserved site
PROSITE profilePS5084831.587233467IPR002913START domain
CDDcd088752.71E-74237463No hitNo description
SuperFamilySSF559612.61E-21240428No hitNo description
SMARTSM002341.7E-17242464IPR002913START domain
PfamPF018521.3E-27246463IPR002913START domain
Gene3DG3DSA:3.30.530.208.2E-6282427IPR023393START-like domain
SuperFamilySSF559612.47E-7488682No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 724 aa     Download sequence    Send to blast
MSDSGKEPIG ELSNSQKRSK RQSQYHRHSM EQIQRLEAFF NKCPHPDEDQ QKQLAREAGL  60
DHKQVKFWFQ NKRTQTKTQN ERSINNALRK EKERLLSENK AMKEAMKNIM CPQCDGPPIG  120
KEERERNIEN MKTENQWLTE QCEKVSNLIS SVVGRPFVMD SNLAPPKLTL GSSSNSSDEN  180
LLNQNICGYP IRYPALCHEN NQNNNNVQAH SININNIPAM SSSPQEHDEF HHDSRQQTIM  240
FETIVASMNE MVELWKTNDP FWVDPSSDEK FSIHRESYGR KYSNQVLPYE TSTTRIESSK  300
DCGIVSMTAV ELIHNFLDPV KWMNLFPTIV TKARTIEVLD SGTWGGSIQL MYEKLHILSP  360
LVEAREFFFI RCCRQLDATT WIMVDVSYDI FNEIQSGAPC YSWKFPSGCV IQDMGNGQSK  420
VTWVEHVQIF EKYQVNRIFR DLLCGREAYG AKRWIVTLQR MSERNSFSMG TTYPTTHDFK  480
GVFHDPKGIK NTIKVSQRMV KSFFEILSMA DKLDFPTSSQ PNRGDRISIR KNEEITQPKG  540
FIAIATTSLW LPRSFQDVFN FFEDDKTRNQ WDILTGENNV IELDRVLTGT FPANNITIIQ  600
PYNMYKEMLV LEEKSINEMG AFLVYAPIEL RVITSIVNGC DATKVPILPS GIIISPDGRL  660
SSNRYNTANA QNGSILTVVF QILICDNNNP TSKQQQMETV ASVHGVLSAT ILKIKEALGC  720
SDL*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755210.0HG975521.1 Solanum lycopersicum chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015087599.10.0PREDICTED: homeobox-leucine zipper protein HDG8-like
TrEMBLK4CUM90.0K4CUM9_SOLLC; Uncharacterized protein
STRINGSolyc09g066030.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10211732
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.11e-151homeodomain GLABROUS 11